Skip to content
ZWordFinderZ

Dictionary

Capsids

c 3a 1p 3s 1i 1d 2s 1

About 2 syllables

noun · 7 letters · Uncommon · plural of capsid

  • Scrabble US & Canada : valid
  • Scrabble UK & worldwide : valid
  • Words With Friends : valid
  • Wordle : not valid

What does capsids mean?

noun

  1. a variety of leaf bug

    Synonymsmirid bugmirid

  2. the outer covering of protein surrounding the nucleic acid of a virus

Definitions shown for capsid, the base form of capsids.

Is CAPSIDS a valid word?

Game / word listValid?
Scrabble US & Canada (NWL / TWL) Yes
Scrabble UK & worldwide (Collins / SOWPODS) Yes
Words With Friends (ENABLE) Yes
Wordle (guess list) No

How many points is CAPSIDS worth?

Scrabble

12 pts
c 3a 1p 3s 1i 1d 2s 1

Words With Friends

14 pts
c 4a 1p 4s 1i 1d 2s 1

Wordfeud

14 pts
c 4a 1p 4s 1i 1d 2s 1

NYT Crossplay

12 pts
c 3a 1p 3s 1i 1d 2s 1

Scores are the sum of the tile values, before premium squares or bingo bonuses.

Words from the letters in CAPSIDS

Words that end like CAPSIDS

Common words that share the ending -IDS, handy for rhymes, poems and wordplay. Matches are based on spelling, so a few may not rhyme exactly.

forbidshybridsorchidsstupidsrapidssolidsacidsbidsridskidseyelidsinvalidspyramidsgridsskidslids
All words ending in -IDS

Capsids: quick answers

Is CAPSIDS a valid Scrabble word?
Yes. CAPSIDS is accepted in both the North American (NWL) and the international Collins Scrabble word lists, and scores 12 points before board bonuses.
How many points is CAPSIDS worth?
CAPSIDS scores 12 points in Scrabble, 14 in Words With Friends, 14 in Wordfeud and 12 in NYT Crossplay. These are plain tile totals, before any double- or triple-letter and word squares.
What does capsids mean?
capsids is the plural of capsid, which means “a variety of leaf bug”. It has 2 meanings in total, listed above.
What words can you make with the letters in CAPSIDS?
You can make 104 shorter words from CAPSIDS, such as CAPSID, ASPICS, SPICAS, ASDICS. See the full list.