Dictionary
Latening
l 1a 1t 1e 1n 1i 1n 1g 2
About 3 syllables
8 letters · Rare
- Scrabble US & Canada : valid
- Scrabble UK & worldwide : valid
- Words With Friends : valid
- Wordle : not valid
What does latening mean?
We don’t have a definition for latening yet. It appears in the game word lists marked below, so it is playable even without a dictionary meaning. That is common for rare, regional and technical words.
Is LATENING a valid word?
| Game / word list | Valid? |
|---|---|
| Scrabble US & Canada (NWL / TWL) | Yes |
| Scrabble UK & worldwide (Collins / SOWPODS) | Yes |
| Words With Friends (ENABLE) | Yes |
| Wordle (guess list) | No |
How many points is LATENING worth?
Scrabble
9 ptsWords With Friends
13 ptsWordfeud
10 ptsNYT Crossplay
12 ptsScores are the sum of the tile values, before premium squares or bingo bonuses.
Words from the letters in LATENING
Anagrams 1
Best shorter words top 30 of 238
aneling 8anteing 8antigen 8atingle 8eanling 8elating 8gelatin 8genital 8gentian 8leaning 8nealing 8tagline 8tanling 8aiglet 7anting 7eaning 7eating 7engilt 7gannet 7gelant 7gelati 7genial 7gentil 7ginnel 7ingate 7innage 7ligate 7lignan 7linage 7taeing 7
See all 238 words made from LATENING Words that end like LATENING
Common words that share the ending -ENING, handy for rhymes, poems and wordplay. Matches are based on spelling, so a few may not rhyme exactly.
happeningopeninghardeninglisteningsaddeningsickeningshorteningfrighteningthreateninglikeningliveningraveningripeningwakeningwideningbrazeningburdeningconveningdampeningdarkeningdeadeningdeepeningfasteningfattening
All words ending in -ENING Latening: quick answers
Is LATENING a valid Scrabble word?
Yes. LATENING is accepted in both the North American (NWL) and the international Collins Scrabble word lists, and scores 9 points before board bonuses.
How many points is LATENING worth?
LATENING scores 9 points in Scrabble, 13 in Words With Friends, 10 in Wordfeud and 12 in NYT Crossplay. These are plain tile totals, before any double- or triple-letter and word squares.
What words can you make with the letters in LATENING?
You can make 238 shorter words from LATENING, such as ANELING, ANTEING, ANTIGEN, ATINGLE. See the full list.
What are the anagrams of LATENING?
LATENING rearranges into GANTLINE.