Skip to content
ZWordFinderZ

Dictionary

Tryptophanes

t 1r 1y 4p 3t 1o 1p 3h 4a 1n 1e 1s 1

About 3 syllables

noun · 12 letters · Rare · plural of tryptophane

  • Scrabble US & Canada : valid
  • Scrabble UK & worldwide : valid
  • Words With Friends : valid
  • Wordle : not valid

What does tryptophanes mean?

noun

  1. an amino acid that occurs in proteins; is essential for growth and normal metabolism; a precursor of niacin

    Synonymstryptophan

Definitions shown for tryptophane, the base form of tryptophanes.

Is TRYPTOPHANES a valid word?

Game / word listValid?
Scrabble US & Canada (NWL / TWL) Yes
Scrabble UK & worldwide (Collins / SOWPODS) Yes
Words With Friends (ENABLE) Yes
Wordle (guess list) No

How many points is TRYPTOPHANES worth?

Scrabble

22 pts
t 1r 1y 4p 3t 1o 1p 3h 4a 1n 1e 1s 1

Words With Friends

23 pts
t 1r 1y 3p 4t 1o 1p 4h 3a 1n 2e 1s 1

Wordfeud

24 pts
t 1r 1y 4p 4t 1o 1p 4h 4a 1n 1e 1s 1

NYT Crossplay

21 pts
t 1r 1y 4p 3t 1o 1p 3h 3a 1n 1e 1s 1

Scores are the sum of the tile values, before premium squares or bingo bonuses.

Words from the letters in TRYPTOPHANES

Words that end like TRYPTOPHANES

Common words that share the ending -ANES, handy for rhymes, poems and wordplay. Matches are based on spelling, so a few may not rhyme exactly.

hydroplaneswindowpaneshurricanesplanesmembranesbiplanesprofanescranescaneslanesmanespanesvaneswanes
All words ending in -ANES

Tryptophanes: quick answers

Is TRYPTOPHANES a valid Scrabble word?
Yes. TRYPTOPHANES is accepted in both the North American (NWL) and the international Collins Scrabble word lists, and scores 22 points before board bonuses.
How many points is TRYPTOPHANES worth?
TRYPTOPHANES scores 22 points in Scrabble, 23 in Words With Friends, 24 in Wordfeud and 21 in NYT Crossplay. These are plain tile totals, before any double- or triple-letter and word squares.
What does tryptophanes mean?
tryptophanes is the plural of tryptophane, which means “an amino acid that occurs in proteins”.
What words can you make with the letters in TRYPTOPHANES?
You can make 1683 shorter words from TRYPTOPHANES, such as TRYPTOPHANE, TRYPTOPHANS, SAPROPHYTE, TRYPTOPHAN. See the full list.